PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P28700_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 260aa    MW: 29554.4 Da    PI: 7.6824
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P28700_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox309.1e-101872212155
                             HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                             k +yps++e+ eLA+++gL+++q+ +WF N+R ++
  GSMUA_Achr10P28700_001 187 KWPYPSETEKVELAESTGLDQKQINNWFINQRKRH 221
                             679*****************************885 PP

2ELK32.51.9e-11141161121
                     ELK   1 ELKhqLlrKYsgyLgsLkqEF 21 
                             ELKh+Ll+KY+gyL+ L+qE+
  GSMUA_Achr10P28700_001 141 ELKHHLLKKYGGYLSRLRQEL 161
                             9*******************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037907.0E-17136IPR005540KNOX1
SMARTSM012551.2E-11138IPR005540KNOX1
PfamPF037892.5E-8141161IPR005539ELK domain
SMARTSM011884.9E-6141162IPR005539ELK domain
PROSITE profilePS5121311.209141161IPR005539ELK domain
PROSITE profilePS5007113.426161224IPR001356Homeobox domain
SMARTSM003891.2E-13163228IPR001356Homeobox domain
SuperFamilySSF466892.22E-20163237IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-27166226IPR009057Homeodomain-like
CDDcd000864.36E-14173225No hitNo description
PfamPF059202.9E-17181220IPR008422Homeobox KN domain
PROSITE patternPS000270199222IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MSHPHYSTLV AAFTDCQKVG APPEVVARLS TIARELASGP SCHNGTSDPD PELDQFMTAF  60
SLSNNIYKRS RTPHVGVSNS FFDLISTPII GITIIITAKG ISIRSTLYEN CEGFGSSEED  120
QNATGDYQVD PQDIDPHADK ELKHHLLKKY GGYLSRLRQE LTKKKKKGKL PKEARQKLLN  180
WWQLHYKWPY PSETEKVELA ESTGLDQKQI NNWFINQRKR HWKPSEDMQF VVMDGFYPQN  240
ASALYMEGQF MGDGIYRLGP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009381883.11e-141PREDICTED: homeobox protein rough sheath 1-like
SwissprotO041351e-92KNAP2_MALDO; Homeobox protein knotted-1-like 2
SwissprotO650345e-93KNOSC_ORYSI; Homeobox protein knotted-1-like 12
SwissprotO804165e-93KNOSC_ORYSJ; Homeobox protein knotted-1-like 12
TrEMBLM0RM940.0M0RM94_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P28700_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40613873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.17e-85KNOTTED-like from Arabidopsis thaliana